Big Tits / Wet ^{140,550 videos}

• 22:30

  Cums In Mouths Vier Geile Titten Und Ein Nerd In Seinem Traum

  TheyAreHuge germanwetold and young (18+)cum in mouthnerdycum on pussy

• 10:02

  I Bring Myself To A Mind-blowing Oragsm. I Come...

  TheyAreHuge russianorgasmsolowettoys

• 05:45

  Big Tits MILF Jessa Rhodes Became So Wet So It Is Perfect Time For Big Cock

  TheyAreHuge handjobwet

• 07:17

  Amazing Tits Alix Lynx Takes A Quick Post-sex Shower

  TheyAreHuge showerwet

• 15:51

  She Pushes The Horny Dildo Herself From Behind In Her Wet Pussy

  TheyAreHuge russianorgasmdildonippleswettoysbig nipples

• 08:42

  Lesbian orgasmic virgin Natasha sexy massage

  TheyAreHuge feetmassagefetishorgasmredheadtattoooil

• 10:12

  Sexy Girl Nikky With Big Tits Sucks A Big Cock Very Sexy And Gets Cum In Her Tight Pussy

  TheyAreHuge cutecreampiePOVwettightkinky

• 10:30

  Angel Youngs Eagerly Runs In For A First Taste Of Jessica Starlings Wet Pussy

  TheyAreHuge kissinglesbianorgasmwetrealityfingering

• 05:40

  Blonde Sex Fiend Nikki Benz Uses Pussy And Tits To Milk Cock

  TheyAreHuge orgasmlactatingmilkwetfake tits

• 12:06

  Watch This Busty Model Suck And Fuck Her Lovers Big Cock

  TheyAreHuge momwetwatching

• 11:44

  Massage Sex Kinky Spa - First Massage Session With Adira Allure & Gia Dimarco Turns To A Sensual Lesbian Fuck

  TheyAreHuge kissinglesbianmassageorgasmhairytattoowet

• 10:15

  Curvy Wet Pussied Slut Amia Miley Rides You To Freedom

  TheyAreHuge POVchubbyridingwetslutfake tits

• 11:56

  Hd And Cummed Big Boibs Meisa Hanai Enjoys Cock Of A Much Younger Lad

  TheyAreHuge asianbathwettitjob

• 06:45

  Busty Kay Lovely Makes Love With Her Bestie Braylin Bailey

  TheyAreHuge cutelesbianfacesittingwetrealitytoyskinky

• 33:08

  That Neat And Tidy Chick With Huge Tits Is A Wild Slut .This Girl Squirts Her Eyes Roll To The Back Of Her Head

  TheyAreHuge castingPOVsquirtchubbyasianorgasmhairy

• 16:42

  Im Cuming AGAIN! Mav & Joey Lee: Breaking In Our New House

  TheyAreHuge wetleggings

• 25:01

  Inexpressible sensations feel the baby when the fucker enters deep into her vagina

  TheyAreHuge ebonyteen anal (18+)vintagewet

• 15:15

  Big Booty Latina Maid Jade Presley Surprise Anal Sex

  TheyAreHuge squirtteasemaidlatinawetshavingsurprise

• 15:32

  Nicole DuPapillon UKs Longest Labia Wanks For Her Co-worker And Shoves A Huge Pink Vibrator Up Her Wet Cunt

  TheyAreHuge maturesquirtorgasmtattoobritishupskirtwet

• 22:01

  Videos That Appeared On Our Site From Nov 3rd Through

  TheyAreHuge compilationshowerwetstanding

• 11:49

  Amateur Babe With A Glass Toy Collection

  TheyAreHuge ebonyteen anal (18+)sologlassescompilationbabewet

• 15:15

  Big Tits Brunette German MILF Alissa Noir Gets Soaking Wet

  TheyAreHuge germanorgasmhairywettoys

• 10:30

  When It Comes To Pottery Pussy Things Must Be Wet JMac Needs To Know It Before He Fucks Violet Gems

  TheyAreHuge POVlatinawetreality

• 09:58

  Amateur Doggy Style Fuck

  TheyAreHuge couplewifewetteacher

• 18:04

  Teen Slut Likes To Play With Herself In The Living Room

  TheyAreHuge tattoocompilationshowerwettoysslut

• 13:26

  Natural Tits Big Black Juicy Cock SLAMS Tiny White Chloe Temple

  TheyAreHuge blacksmall cockcoupleinterracialfacialwetsmall tits

• thumb_up 82% 12:27

  Hottie Anya Krey Wants To Learn How A Vintage Granny Pussy Can Be Wet

  TheyAreHuge grannyhairyass lickingvintagewetold and young (18+)

• 14:53

  Nicole DuPapillon UKs Longest Labia Employee Pep Talk JOI

  TheyAreHuge maturefemdomsquirtorgasmtattoobritishupskirt

• 04:51

  Pee With Creampie Public Outdoors

  TheyAreHuge pissingpubliccreampieoutdoorsolowet

• 12:55

  Top Primer Reality Show Porno Peruano, Que Pase El Pervertido

  TheyAreHuge cheatingredheadlatinagroupwet

• 19:50

  Milf Fuck Her Pussy While Filming In My Pussy

  TheyAreHuge threesomesolopiercingwettoys

• 09:07

  Nicole DuPapillon UKs Largest Labia Home From Work Gagging To Suck Cock

  TheyAreHuge maturegaggingsquirtteasebritishwetshaving

• thumb_up 67% 31:13

  Big Titty MILF Slides A Dick Inside Her Wet Hairy Cunt

  TheyAreHuge momcreampiesquirthairy18wetcum on pussy

• 11:24

  Horny Girl In The Car

  TheyAreHuge publiccoupleoutdoorcartattoowetreality

• 15:21

  Hot and juicy(wet) compilation of squirts and orgasms from an insatiable teen.

  YourLust orgasm compilationwet

• thumb_up 78% 12:07

  Lesbian 4 Way Has A Sexy Babe Riding The Fucking Machine

  TheyAreHuge partyridingbabewetshavingmachine

• 15:28

  Chloe Opens Her Legs And Shoves Two Fingers In Her Wet Twat

  TheyAreHuge compilationwetheels

• 12:40

  Asians And Showering Sexy Masseuses Play With Each Other

  TheyAreHuge kissingmassageinterracialasianfacesittingoilshower

• 19:55

  Unable To Orgasm Is Soon To Be No Problem As The Milf Came

  TheyAreHuge stockingsorgasmfacialwetheels

• 08:23

  Milfs Katarina Hartlova - Slippery When Wet

  TheyAreHuge solowet

• 16:42

  Busty Step Sis Kenzie Madison Makes Her Pink Pussy Wet For Her Step Brothers Fat Cock

  TheyAreHuge cutefatPOVwetdomination

• 11:46

  Skyla Novea Is The Busty Step-sister Every Guy Wants

  TheyAreHuge latinashowerwetshaving

• thumb_up 80% 11:11

  Stocki HARD HAIRY PUSSY DESTRUCTION BY A GIANT DILDO AND FISTING OPEN PUSSY

  TheyAreHuge feetstockingsstraponhuge dildofetishteasefisting

• 05:50

  Raceplay Busty Masseuse Milks A Huge Fucking Black Rod

  TheyAreHuge ebonyblackmassagewifeteen anal (18+)milkshower

• 29:04

  Wet party with beautiful babes

  TheyAreHuge partybabewet

• thumb_up 73% 08:40

  Upskirt Submissive Girl In Uniform Follows Instructions

  TheyAreHuge stockingsinstructionuniformupskirtpantieswetshaving

• 11:02

  Gorgeous Amateur MILF Getting Horny In The Bathroom

  TheyAreHuge momwifeshowerwetbathroomgorgeous

• 13:15

  Cougars And Touching Boobs Sexy Busty Russian Crystal Rush Gives Her Pussy As A Tip During This Filthy Massage

  TheyAreHuge feetcreampiemassagefetishrussianteasegloves

• 06:46

  Busty Czech Cougar Satin Bloom Toys Her Tight Wet Pussy With A Shiny Dildo Until She Cums

  TheyAreHuge creampiesatinczechdildowetcougartoys

• 11:17

  Giant Tits And Huge Tits I Fuck Step Sister And She Let Me Cum Inside Her Pussy

  TheyAreHuge chubbywetcum on pussy

• 10:28

  Gorgeous Babe Lily Lou Gets Horny When Will Pounder Massages Her Back Down To Her Ass

  TheyAreHuge massageshort hairfacialass lickingbabewetass

• 07:53

  Two Hot Maids With Big Tits Having Interracial Foursome With The House Winer

  TheyAreHuge ebonyindianinterracialwifemaidgirlfriendwet

• 10:19

  Woman With Juicy Butt Sucks Studs Cock Before Sex In Bathroom

  TheyAreHuge showerwetold and young (18+)shavingbathroomstanding

• 09:34

  Chubby While My Best Friend Plays On The PC I Take Advantage And Fuck His Stepmother, What Good Sex I Have The Best Friend Who Lends Me His Stepmother To Fill Her With Milk Every Time I Go To Her House

  TheyAreHuge chubbywifehairylactatingcuckoldmilkgirlfriend

• 13:05

  Gorgeous Shalina Devine Has A Lot Of Fun With Sexy Zazie Skymm And A Vibrator

  TheyAreHuge kissinglesbian69wettoysvibratorgorgeous

• 06:00

  I Know You Are Checking Me Out, StepNephew.. Wanna Fuck Me?

  TheyAreHuge outdoorpoolbikiniwet

• 16:10

  Geiler Dreier Mit Dicken Titten

  TheyAreHuge germanthreesomewet

• 10:24

  MILF Is So Sexy That Pervert Walks Into Bathroom And Fucks Her

  TheyAreHuge matureshowerwetold and young (18+)shavingbathroomstanding

• 19:45

  Pink Pussy Teen With Big Tits Skips School To Squirt Schoolgirl Caught Squirting

  TheyAreHuge straponsquirtsolocaughtwetschool uniform

• 06:04

  Hot Big Tits Nikki Rides A Big Cock Cowgirl And Enjoys It

  TheyAreHuge ridingwet

• 05:55

  Busty Milf Toys A Petite Maid Wet Pussy

  TheyAreHuge kissingmaidredheadwettoysboss

• 06:08

  Lusty Big Tit Lesbian Hot Babes Kit Mercer, Gizelle Blanco Lick Their Big Boobs And Juicy Pussies

  TheyAreHuge kissingorgasmbabewetshavingpussy licking

• 12:06

  Sexy Blowjob Babes Big Natural Tits Bounce As She Rides A Cock

  TheyAreHuge momridingbabewetkinkybeauty

• 13:49

  Doggy Fuck And Loaded THICK TEEN Daniella Margot HARDCORE THREESOME With BIG ASS MILF Angel Wicky

  TheyAreHuge threesometeen anal (18+)groupwettoysthickkinky

• 07:49

  Big Bouncing Tits Jasmine Black Huge Cock Sharing Stacey Saran Bathroom Fuck Buddies

  TheyAreHuge blackthreesomelatinaromanianshowerbikiniwet

• 07:45

  MILF With Huge Tits Like Her Protein Shake Organic

  TheyAreHuge oilwetsport

• 15:15

  Huge Ass And Tits Latina Sheila Ortega Solo Vibrator Orgasms

  TheyAreHuge teen anal (18+)latinaglasseswetvibrator

• 11:37

  Interviewing Casting Big Ass Desperate Amateurs Nasty Milfs Compilation

  TheyAreHuge castingmominterracialwifecompilationauditionwet

• 17:11

  Nicole DuPapillon UKs Longest Labia Plays With Her Pussy Wet Panyies JOI

  TheyAreHuge straponsquirtorgasmbritishwetlong hairJOI

• 16:06

  Alisa Is A Beautiful Young Wife Who Is Always Cheating On Her Husband. She Is Obsessed With The Other Guys Dick. Alisas Vagina Is Filled With His Thick Sperm....

  TheyAreHuge asianwifecheatingjapanesehusbandshowersperm

• 07:35

  Im Sure Youd Like To Be In That Pillows Place, Wouldnt You?

  TheyAreHuge POVwet

• 06:38

  CORRIDA SUPER CREMOSA

  TheyAreHuge feetsquirtfetishasianteen anal (18+)orgasmsolo

• 04:55

  Big Cocks Encontre A Mi MADRASTRA En La Ducha Y No Me Pude Resistir Y Termine Follandome El Coño Apretado Que Tiene

  TheyAreHuge cuteBBWshowerwetass

• 06:00

  Big Tit And Horny Blonde Sluts Serene Siren, Jazlyn Ray Finger Fucking From Behind And Reach Intense Orgasm

  TheyAreHuge kissingorgasmfacesitting69wetslut

• 10:40

  Hot Cheerleader Gets Fucked&creampied By A College Player

  TheyAreHuge creampiesquirtteasewetcollegerealitycheerleader

• 07:59

  Share This Naked Beautys Pleasure As She Fingers Her Wet Pussy

  TheyAreHuge short hairstripwetheelskinky

• 12:09

  Dripping Wet Lesbian Baddies Try Some Bubble Bath Rimming (Veronica Leal, Sybil)

  TheyAreHuge threesomebathfacesittinglatinaass lickingwettoys

• 06:08

  Amazing Natural Busty Lesbian Hotties London River, Lilly Bell Eating Each Others Wet Cunts

  TheyAreHuge kissingorgasmwet

• 12:00

  Big Tit Slutty Stepsister Alyx Star Fucks Big Cock

  TheyAreHuge creampiecoupleshowerwetshavingcum on pussy

• thumb_up 80% 05:59

  Milf STEP MOM!? What Are You Doing Here? - Alexis Fawx

  TheyAreHuge mommassageoilstepmomshowerwetstanding

• 24:34

  Crazy gangbang where everything is possible

  TheyAreHuge gangbangwet

• 05:55

  Blonde Horny Busty Teens Braylin Bailey, Nikki Sweet Kiss Tender And Eat Their Juicy Pink Pussies For Strong Climax

  TheyAreHuge ass lickingwet

• 22:48

  To Get On Her Husbands Good Side Busty Blonde Milf Offers

  TheyAreHuge stockingsthreesomehusbandwetwatching

• 05:55

  Lovely Teen And Mature Lesbo Couple Reagan Foxx, Katie Kush Finger Fuck Thei Bald Pussies And Lick Deep

  TheyAreHuge ass lickingwetpussy lickingsensual

• 06:18

  Beautiful Asian With Awesome Body And Tattoos Rides My Hard Dick And Gets Fucked Missionary - Lulut Wet & Tony Impale

  TheyAreHuge coupleinterracialasiantattooridingwet

• 10:09

  Fucking A Super Hot MILF Amber Jayne

  TheyAreHuge kissingcreampiepoolbritishwetass

• 14:55

  Hottest Karma Rx Scenes From Blowpass

  TheyAreHuge tattoooilcompilationhandjob compilationwet

• 06:00

  Amazing And Natural Busty Lesbian Babes Gizelle Blanco, Arla Taylor Getting Horny And Lick Each Others Holes

  TheyAreHuge orgasmbabewetkinkysensual

• 06:00

  Hot Lesbian Busty Girls Eating Pussies On The Massage Table And Make Each Other Cum (haley reed)

  TheyAreHuge massageorgasmredheadwetcum on pussy

• 09:45

  Robotic Dildo From LustyTime Makes Me Squirt- Wet Kelly

  TheyAreHuge squirtteasedildowettoysmachineseduced

• 08:41

  Lady Masha Loves Taking A Bath With Her New Toy

  TheyAreHuge maturewifebathsoloshowerwet

• 06:51

  Step Sister Valentina Tricked Into Fucking Santa

  TheyAreHuge creampieteasewetrealityseducedtrickedcosplay

• 26:24

  During A Health Examination, The Busty Brunette Discovers

  TheyAreHuge fatsquirtteasefacialwet

• 39:21

  BIG BOOBS AND WET PUSSY

  TheyAreHuge creampiewetBBC

• 10:27

  Alix Teases Her Big Tits And Wet Pussy

  TheyAreHuge teasesolowet

• 17:00

  Plumper Aroused Stepdaughter Begs For Her Daddy To Creampie Her FULL

  TheyAreHuge wet

• 12:00

  Brune Alyx Star,Mckenzie Lee,Sheena Ryder Are Making Some Great Uses Of A Strap On Live On JerkmateTV

  TheyAreHuge straponthreesomeorgasmbritishwetshavingtoys

• 17:15

  Perfect Body Stacy Cruz Gets Hot Creampie In Her Wet Pussy

  TheyAreHuge wetperfect body

• 05:55

  She Reaches Her Promised Virgin Orgasms Via Massage

  TheyAreHuge couplemassageorgasmwetromantic

• 13:45

  Juggs WhiteBoxxx - Liya Silver Big Tits Russian Teen Hot Massage With Anal Sex Surprise (+Kristof Cale)

  TheyAreHuge massagerussianteen anal (18+)orgasmtattoowetshaving

• 06:41

  Round Butt Naughty America - Blake Blossom Shows Off Her Big Tits And Wet Pussy To Her Hunky Masseur (with Quinton James)

  TheyAreHuge creampieass lickingweteroticpussy lickingcum on pussy

• thumb_up 91% 12:39

  Blonde lesbian Gina Gerson threesome gets wet and wild during backyard dildo anal with Veronica Leal

  TheyAreHuge threesomerussianhairydildoass licking69wet

• 20:25

  I Fulfill My Fantasy Of Having A Lesbian Threesome With My Best Friend And Her Stepmom! Naty Delgado, Silvanalee & Kem

  TheyAreHuge latinastepmomwetheelsfantasy

• 12:23

  Spanking She Knows What To Do With Her Ass POV

  TheyAreHuge couplemassageoilspankingshowerwet

• 22:30

  Pov And Sextoy The Sexy Employee From The Photo Studio

  TheyAreHuge germanwet

• 07:41

  Student With Big Boobs In Red Panties Plays With Her Clit In The Bedroom

  TheyAreHuge russianstudenthairyclitpantieswetbig clit

• 08:34

  Charley Plays With Her Pussy

  TheyAreHuge wet

• 15:35

  She Takes His Fat Cock In The Shower: Mav & Joey Lee

  TheyAreHuge fatgaggingpiercingnipplesshowerwetbig nipples

• 06:05

  Busty Milfs Suck N Fuck Outdoor Gangbang

  TheyAreHuge partyoutdoorpoolfacesittinggangbangbikinigroup

• 09:58

  FFM Threesome With MILF Rachael Cavalli & Tattooed Tart Kali Roses

  TheyAreHuge kissingthreesomefacesittingtattoostepmomFFMwet

• 14:46

  Porn Star Bunny Madison Tells Molly Little, This Is So Fucked Up, But Its Making Me So Wet

  TheyAreHuge threesomefacesittingnippleswetbig nipples

• thumb_up 60% 12:22

  Hottie Wants To Learn How A Vintage Pussy Can Be Wet

  TheyAreHuge grannyfetishass lickingvintagewetold and young (18+)

• 10:22

  Victoria White Shares Her Wet Pussy

  TheyAreHuge solowet

• thumb_up 46% 09:46

  Mature Pissing Mature Lesbians And Licking Hairy Wet Pussy In Urine. Fat Milfs Love Dirty Fetish. Amateur POV. PAWG Doggystyle. ASMR.

  TheyAreHuge pissingmaturefatfetishhairyBBWwet

• 19:19

  Granny With Eager Pussy Gets Penetrated By Lover

  TheyAreHuge maturegermangrannyfacialwetkitchen

• 05:56

  Milfs A Busty Granny

  TheyAreHuge grannyBBWshowerwet

• 12:40

  Wooty Booty Athena Faris Has Some Wet Fun With Her College Swim Team Besties After Trying New Swimwears

  TheyAreHuge teen anal (18+)outdoorass lickingwetcollege

• 43:14

  Huge Boobs Teen Spreads Her Pussy And Masturbates With Magic Wand

  TheyAreHuge wetwebcam

• 19:09

  Holiday Lesbian Sex Between Emo Girl Cathy B And College Teen Alice

  TheyAreHuge emogermanshowerwetcollege

• thumb_up 60% 09:15

  Fuck I LOVE When My CUCKOLD HUBBY Watch Me Getting CREAMPIE!! I Am The Perfect CHEATING WIFE!!

  TheyAreHuge chubbywifecheatingcuckoldhusbandwetwatching

Popular categories

Free sites