Grote Tieten / Flexibel ^{2,866 videos}

• thumb_up 70% 26:16

  Chubby blonde rides dick to get sperm on her body

  xTits spermavies praten

• thumb_up 60% 22:10

  Obedient lad obeys all orders of a mature lady

  xTits oude man

• 41:09

  3D babes satisfy every desire a dude can have

  xTits plassenkussen3Dvies pratennaterotisch

• 30:42

  Stacey Saran and Princess Paris throw a threesome on a lawn

  xTits taxi

• thumb_up 60% 32:37

  Deauxma seduces a fresh lad into fucking her

  xTits verleiden

• 50:17

  Video games chicks come together for a sex party

  xTits feestjespelletje

• 30:55

  Cutie bends over the bed so a friend can drill her hairy pussy

  xTits kussenharigvies pratenmokkel

• 20:00

  Two chicks moan while they fuck in office

  xTits vies praten

• 40:30

  Summer Carter tests Alli Rae in a bisexual orgy

  xTits bisexueel

• 20:31

  Four hot chicks punish one another in an orgy

  xTits kussenvies pratennatorgie

• 21:35

  Chocolate babe in white stockings opens hairy pussy

  xTits harigclitvies pratengrote clit

• 23:41

  Pervy Senior Doctor Exams Young Stunners Body And Holes

  Analdin dokterziekenhuis

• thumb_up 68% 23:36

  Elderly lovers satisfy their crazy sexual desires

  xTits vies praten

• thumb_up 59% 38:45

  Arab brunette pleases her well-hung boyfriend

  xTits arabischvies praten

• 1:04:07

  Hot college girl doing her workout routine

  Beeg dans

• 36:04

  Busty babe seduces a salesman with her boobs

  xTits knipperendroemeensrealiteitsensueel

• 15:01

  Lusty babe Alexis Crystal gets fucked by three massive cocks

  OkXXX natuurlijkgangbangslaapkamermissionaris

• thumb_up 71% 19:45

  Busty Big Ass 56yo ginger mature GILF Melanies hot workout - flexible mature grandma

  xTits natuurlijkgrote tieten

• 36:44

  TeamSkeet - Bored Amateur Babe Deepthroats Big Latino Cock And Swallows Huge Load Of Cum

  xHamster mager

• 15:01

  Bianca Casanova Fucks Her Plumbers Massive Cock!

  PornHat molligmissionarisloodgieter

• thumb_up 56% 29:49

  Stunning brunette Compilation Cumshots on Big Tits

  xTits roemeensvies pratenklaarkomen compilatie

• 21:35

  BUSTY GIRL SHOWS HOW SHE MASTURBATES OMEGLE

  xTits openbaarbuitenknipperendvies pratenflexibelwebcam

• 25:45

  Old Boss Fucks his Big Tits Secretary in his Office

  xTits kantoorvies pratentietenklussecretaresseboss

• 29:03

  Skinny brunette squeezes dick with her big boobs

  xTits kussenknipperendhondje stijltepelstietenklusflexibelgrote tepels

• thumb_up 67% 20:44

  Busty 45yo lady in stockings rubs cunt on camera

  xTits kussenknipperendvies praten

• 16:09

  German ebony mom milf with big tits make threesome mmf milf

  xTits drieëntepelstietenklusflexibelvingeren

• 41:20

  Half-naked milf craves for a big black cock

  xTits knipperendvies praten

• 33:12

  Petite blonde with big natural tits fuck stranger

  xTits kussentaxivreemde

• 22:09

  Busty MILF knows what she wants from a big black dude

  xTits kussenzwartfetischknipperendvies pratenmokkelflexibel

• 23:00

  Busty blonde and her man fuck deep in the night

  xTits kussenknipperendnatflexibel

• thumb_up 88% 1:09:20

  Babes Suck, Lick, Slap and Pinch Big Lesbian Tits

  xTits vies praten

• thumb_up 85% 22:42

  Brunette teen with big tits takes a bath

  xTits baddouchevies praten

• 26:23

  Red-haired cutie shows her boobs on camera

  xTits fransdoktervies praten

• 20:17

  BBW blonde hairy mom plays with big dildo

  xTits harigdildovies praten

• thumb_up 59% 22:54

  Naughty blondie blows big cock and rubs it with boobs

  Analdin tjechischkont naar mondvies praten

• 18:18

  Flexi Teen Contortionist Masturbating

  $$ FapHouse tepelsuitgezakte tieten

• 20:10

  Bare Yoga: Balancing practice flow - yoga with grey

  MatureClub flexibel

• 36:36

  Foursome Gymnast Dancers have Orgy sex

  JizzBunker anaalgangbang

• 26:34

  Scissoring in lesbian xxx with seductive Leigh Raven and Valerica Steele from She Will Cheat

  PornHat brunettelesbische verleiding

• 24:10

  TeamSkeet - Little Sweet Babe With Caramel Skin Gabriella Ford Surprises The Naked Neighbour

  xHamster buurvrouw

• 38:22

  Leah Gotti - erotic hardcore with young all natural brunette

  xTits flexibel

• thumb_up 56% 24:02

  Cutie comes to singing contest but gets a fuck

  xTits wedstrijd

• 38:03

  Monster Girl Island Cartoon Porn

  xTits kussenlesbischknipperendmonsertietenklusromantisch

• 20:14

  Hot Swingers in MMF Threesomes, FFM Threesomes, Foursomes & Group Orgies

  xTits swingerdrieënvies praten1 man 2 vrouwengroeporgie2 mannen 1 vrouw

• 54:11

  Pregnant babe gets tattooed and facialized

  xTits zwanger

• thumb_up 82% 44:33

  Yummy brunette goes news casting in sperm rain

  xTits bukkakesperma

• 31:57

  Korean BJ Subin Puts a Screwing Toy into her Cunt.

  xTits koreaansvies praten

• thumb_up 54% 1:59:31

  Teen with Perfect Body Loves Cumming on Cam

  xTits spuitenklaarkomen op kutje

• 20:55

  3D chick gets her morning fuck from behind

  xTits 3Dvies praten

• 33:11

  Glam brunette masturbates with pussy beads

  xTits vuistneukentjechischvies praten

• thumb_up 88% 28:45

  Kinky therapeute helpt haar patiënt met harde seks

  xTits vies pratennylon

• 28:54

  Brunette Eva Karera wants a fat dick on couch

  xTits vetdrieënorgasmekont naar mondflexibel

• thumb_up 83% 48:48

  Milf and teens throw a bisexual threesome scene

  xTits bisexueelvies praten

• 37:29

  Linda Lay needs cash to become a hot doctor

  xTits gelddokter

• 16:01

  Naked lesbos throw a catfight on the ring

  xTits flexibel

• thumb_up 60% 30:50

  Pregnant lesbian babysitters lick juicy cunts

  xTits kussenzwangervies praten

• 21:44

  Two cuties in sexy lingerie satisfy lads on table

  xTits fransvies pratenescort

• 24:36

  Lesbo chicks lick each other by turns in kitchen

  xTits vies pratenkeuken

• 24:38

  Half-naked babe gets her desired satisfaction

  xTits vies pratenhongaars

• 31:55

  Sexy babe in leather skirt and stockings gets fucked at office

  xTits kantoorleerrokje

• 20:09

  Curly haired milf in sexy lingerie gets a good nailing in bed

  Analdin krullend haar

• 22:13

  Pregnant ebony babe milks her giant boobs

  xTits zwartzwangerlacterenknipperendmelkflexibelgrote tepels

• 23:03

  Hottie with huge boobs shows them everywhere

  xTits kussenknipperenddoucheflexibel

• 28:21

  Slim brunette plays with her gentle boobs

  xTits vies pratenmagerberoemdheid

• 39:26

  Asian babe takes off kimono to tie up her boobs

  xTits kussenaziatischjapansknipperendvastgebondendouchevies praten

• 32:18

  Busty Latina gets fucked by the pool doggy style

  xTits buitenzwembadvies pratenflexibel

• 23:35

  Sexy Babe Is a Scaredy Cat On a Sex Walk 2

  xTits BDSMvies praten

• 16:45

  LP Officer Will Brings The Senators Daughter Into The Back Office After She Is Caught Shoplifting

  SunPorno winkeldief

• 29:44

  Bad Girl Fucking In The Bed With Her Medium Ass - Luna star

  xTits gespierdnep tieten

• 1:36:47

  Chicks in superhero outfits open their wet holes

  xTits vies pratenparodiecosplay

• 22:27

  Chubby chick and a skinny lad fuck in gym

  xTits vies pratengymmagerretro

• 59:54

  MomShoot - Sexy Housewife With Massive Tits Shoots Porn Tape

  SexPlex huisvrouw

• 31:53

  Kittyred-haired blows cock and squeezes melons

  xTits rokenroodharige

• 15:19

  I Stretched Remy Rune Flexible with My Big Dick Then Gave Her a Huge Cumshot in PornDudeCasting

  AnyPorn sexy moedernep tieten

• 27:24

  Flexible Teen with Big Ass and small saggy Tits

  VipTube grote tieten

• 38:58

  Bigass flexible babe squirts: Big Tits, Big Ass Solo Porn

  JizzBunker grote tieten

• 27:24

  Flexible Teen with Big Ass and small saggy Tits seduce to Rough Hard Fuck by Big Dick Boy

  JizzBunker uitgezakte tieten

• 27:26

  Lithe teen Ann Marie with a big ass and small tits gets seduced for some rough action by a well-endowed guy

  XXXVogue grote tieten

• 25:35

  Flexible Busty Tattooed Brunette

  XXXDan knipperend

• 15:01

  Flexible brunette with big booty Gloria Cruise nailed from behind

  OkXXX grote tieten

• thumb_up 69% 27:45

  Skinny Flexible Redhead Long Stroked By GIANT BBC

  xHamster flexibel

• 28:02

  Massive Tit Flexible light-haired Motivated To cum

  VideoSection flexibel

• 36:49

  Beautiful flexible russian with big ass

  XXXDan flexibel

• 26:21

  Flexible Busty Latinas Fucking in Group sex orgy - Extreme Sex Positions Contest - Big tits

  xTits echtgenote

• 15:58

  Hot Flexible Asian With Big Tits & Nippleshas Her Leg Pulled Up & Suspended! Cums Over & Over

  Upornia flexibel

• 16:25

  Coco Lovelock - Flexible Busty Petite Gets Her Tight Pussy Smashed By Hunk Security Guard

  HClips flexibel

• 45:33

  GotMylf - Flexible Tattooed Milf With huge boobs Works Out Her snatch Muscules With Athletic Trainer

  VideoSection naakte man aangeklede vrouwhuisvrouw

• 26:28

  Eva Long - Free Premium Video Flexible Stepmom With Big Juicy Tits Gives Nude Yoga Lesson And Jerks You Off

  Upornia stiefmoeder

• 22:16

  First gangbang with flexible busty MILF in lederhosen

  XXXDan gangbang

• 15:36

  TeamSkeet Selects - Top Compilation Of massive titted brunette Pornstar Savannah Sixx Getting Fucked

  MatureClub stiefmoedercompilatie

• 42:31

  Flexible Busty Japanese babe Azumi gang fucked hard

  TXXX flexibel

• 25:41

  Sheena Ryder In Flexible Rides His Big Dick

  Upornia flexibel

• 40:53

  Lucy Doll - Fucks Tiny Flexible That Loves Big Dick

  Upornia flexibel

• 20:13

  Flexible Girl With Big Tits Puts On Stockings And Masturbates On

  Upornia flexibel

• 18:38

  Flexible busty brunette chubby gets weirdly ass fucked

  XoZilla flexibel

• 26:51

  Ricki White rubs big dick with her yummy boobs

  xTits kussenfetischknipperendflexibel

• Gisteren 15:02

  Flexible Latina Geisha Kyd Seduced Mid-workout Fuck Fest

  TheyAreHuge brunette

• 34:16

  HUGE MASSIVE BOUNCING BOOBS POV COMPILATION

  xTits kussenknipperendcompilatieflexibelvingeren

• 25:53

  HUGE MASSIVE NATURAL BOOBS POV COMPILATION

  xTits kussenknipperendflexibelvingerenuitgezakte tieten

• 6 dagen geleden 15:19

  The Curvy Flexible Fuckdoll - Nia Bleu

  JizzBunker rijp

• 6 dagen geleden 48:49

  Desirable Danny and Kays natural tits xxx

  PornHat tiener (18+)

• 1 week geleden 16:38

  Dad Crush - flexible smut

  PornHat flexibel

• 6 dagen geleden 15:19

  Alyson Mystery: Flexible Freckle-Faced Squirt Queen

  XXXDan klaarkomen

• 1 week geleden 37:30

  Perfect Boobs and Ass

  $$ FapHouse missionaris

• 1 week geleden 27:35

  Cheating Foreign Busty Flexible Slut Escapes Russian for BBC

  $$ FapHouse grote zwarte pik

• 1 week geleden 19:48

  Flexible Black Hair Step-Sister With Big Tits And Pussy Tattoo Help To Relax By Huge Cock Boy With Sex

  TheyAreHuge grote tieten

• 3 weken geleden 21:45

  Nicole Doshis Flexible Fuck: detect How Far She Can spread Her legs (and Her Pussy)

  VideoSection klaarkomen in mond

• 2 weken geleden thumb_up 20% 16:07

  Flexible Big Titty Wife Shows off Riding and taking Dick in different Positions- Creampie Drip

  XXXDan gezichtspunt

• 3 weken geleden 19:07

  Sexy Ballerina Vinna Reed Erotic Affair with a Big Dick - Erotique Sex

  $$ FapHouse koppel

• 3 weken geleden 33:21

  To reveal her flexibility skills white chick Lea Lexis needs a bbc to showcase on

  VideoSection blond

• 3 weken geleden 31:39

  Gambling Quinton and Annas natural tits trailer

  PornHat spuiten

• 16:16

  Zac Wilds big cock movie by Adult Time

  PornHat vingeren

• 4 weken geleden 15:19

  A Pov Anal Session With Your Naughty Flexible Skinny Client Alexa Flexy

  JizzBunker gezichtspuntmollig

• 4 weken geleden 20:38

  Fiery flexible redhead babe Lauren Phillips does tit fuck, 69 and facial hardcore live

  JizzBunker grote tieten

• 17:45

  PAWG MILF Kelsi Monroe Shows Her Flexibility and Gets a Throatpie

  JizzBunker rijp

• 15:07

  First big pink cigar ass fucking for ultra-cute shy teen

  VideoSection kousen

• 16:30

  Busty MILF Shows Her Extreme Flexible Body

  $$ FapHouse solo

• 15:02

  Khloe and Layas flexible clip

  PornHat grote tietenflexibel

• 20:45

  Mylf - Gorgeous Hottie With Toned Body Takes A Giant Dong And Slurps His Protein After A Hard Fuck

  SexPlex flexibel

• 45:09

  GotMylf - Flexible Tattooed Milf With Big Tits Works Out Her Pussy Muscles With Athletic Trainer

  SexPlex gespierd

Populaire categorieën

Gratis sites