Große Titten / Windel ^{334 Videos}

• 14:02

  Diaper Handjob

  TXXX windel

• 17:28

  Deine Hemmungen zerstören und dich wickeln - Penney Play

  Upornia windel

• 08:21

  Longpussy, just a little cooking sequence

  JizzBunker ehefrau

• 06:18

  Pee, Anal gape, ABDL, Enema, Ass to gullet, Compilation vid

  HDSex pissenwindelklistier

• 08:00

  Penny Barber – Valentine’s Day Diaper Punishment

  xMILF windel

• thumb_up 85% 16:06

  Diaper Playdate Fuck With Penney Play

  Upornia pissenwindel

• 10:53

  Adriana nappy In shower

  HDSex windel

• thumb_up 70% 24:59

  Windel nach einem Unfall

  TXXX fetischwindelunfall

• 08:18

  Pregnant milf with diaper in the bath

  TXXX schwangerwindel

• 06:27

  I masturbate in a diaper and show my hooters

  HDSex große tittenwindel

• 06:13

  Diaper Fetish Masturbation And Cum On Diapers

  HClips windel

• thumb_up 86% 04:19

  Diaper Girl

  HClips windel

• 04:23

  Big Tits Diaper Girl Desperately Wetting And Cumming In Diaper

  Upornia windel

• thumb_up 87% 07:09

  Sie fickt die Windel

  TXXX britischwindel

• thumb_up 58% 37:41

  Valentine’s Day Diaper Punishment With Penney Play

  Upornia windel

• thumb_up 40% 10:26

  Mommies Windel-Poolboy mit Penney beim Spielen

  xMILF windel

• thumb_up 57% 09:56

  Girl Wets Bed Gets Diaper

  Upornia fetischwindel

• thumb_up 83% 21:17

  Diapered By Your Tinder Date - Penney Play

  HClips windel

• thumb_up 56% 08:38

  Stepfather Changes Daughters Diaper And Leaves A Creampie

  HClips windel

• thumb_up 50% 31:11

  Old Man In A Baby Diaper Gets His Ass Fucked With A Toy

  HClips herrinstraponalter mannfetischwindelkehlenfickspielzeug

• thumb_up 58% 13:46

  Diaper Handjob

  HClips windel

• thumb_up 14% 15:37

  I wear a big dirty diaper and destroy it all

  xHamster italienischwindel

• 16:57

  Solving Your Small Penis Problem With Diapers With Penney Play

  HClips windel

• thumb_up 55% 17:01

  Penney Play - Dreaming Of Diapers And Blowjobs

  HDZog handarbeitstrümpfewindel

• 17:45

  Roommates Share Diaper Fetish

  HDZog windel

• 05:57

  Girls get diapered for wetting jean diaper punishment

  DrTuber windel

• 11:59

  Bratty Girls Get Diaper Time

  TXXX windel

• 11:44

  WonderWoman Diapered

  HDZog windel

• 07:24

  Courtney messes double diaper

  TXXX windel

• 13:47

  Adriana Cleans Microwave in Messy Diaper

  TXXX windel

• thumb_up 83% 02:26

  Star Messes Her Diaper After Getting Constipated!

  TXXX windel

• 08:21

  Longpussy, just a little kitchen footage.

  xHamster schlaffe tittchenwindel

• 07:37

  Babied and Diapered JOI

  JizzBunker windel

• 08:44

  Long pussy, stretching outer labia and some random videos in the kitchen

  XXXDan windel

• 21:48

  Longpussy, walk at a Public Park in Heels with a Huge, Full Diaper after a Long Drive and my Evening Shower before my Pussy gets

  xHamster schlaffe tittchen

• thumb_up 91% 06:01

  Vocal, Asmr Diaper Peeing After Holding For 24 Hours!

  HClips ASMR

• thumb_up 62% 11:00

  Sissy Diaper bedtime

  HDZog windelsissy

• thumb_up 67% 06:13

  Pissing My Diaper And Humping It

  ManySex pissenwindel

• 17:10

  Penney Play - Destroying Your Inhibitions And Diapering You

  HDZog windel

• 10:24

  Tied up diaper orgasm

  TXXX windel

• 15:34

  Adriana Dressing Over Messy Diaper

  HDZog windelkleid

• thumb_up 60% 10:33

  Fearless, Rebellious, Sexy: WONDER WOMAN Is My Erotic Dream Even If She Wears Diaper Under Armor

  TheyAreHuge windelerotikcosplay

• 25:47

  Dominant chick bangs a dude in diaper with a strap-on

  XoZilla windelbehunderung

• 04:26

  Soaking My Diaper While At The Hotel

  HClips pissen

• 04:31

  Diapers And Shaving Cream Oh My!

  HClips windel

• 10:51

  Cosplay big tits, super villains, superheroine

  HDSex windelcosplay

• 11:44

  Big Diaper Dity With Piss And Tampax All Wet For You

  Upornia haarigwindel

• 24:36

  Busty Blonde Mom Big Man Baby - Diaper Fetish With Kendra Sunderland

  Upornia muttifetischwindel

• 10:38

  Triple diaper swimsuit

  TXXX windelbadeanzug

• thumb_up 82% 11:15

  Club girl in diapers

  TXXX windelclub

• thumb_up 20% 04:55

  Hot diaper girl farting and messing diaper

  TXXX windel

• 29:13

  Real couple, taunt

  VideoSection windel

• 06:28

  Milf With Big Tits Bangs Guy In Diaper By Strapon

  TXXX windel

• 07:59

  I like to indulge my wifey with gropes after work

  HDSex befummelt

• 06:33

  Mommy Wants a show - bodacious Femdom JOE All Genders

  HDSex windel

• 24:40

  Blonde Mommy Breastfeeding Dude In Diapers With Soother - Fetish

  HDZog fetischstillenwindel

• 09:27

  European woman explores her diaper fetish through intimate solo play

  YesVids solo

• 07:37

  Unleash the Dirty Diaper Changer in Arimura Nozomi with her Massive Tits - Asian slut!

  AnyPorn strümpfe

• 05:14

  Big-boobed Indian wife kisses ass with massive tits

  XXXVogue windel

• thumb_up 63% 23:27

  Two women dominate a diapered man in a strict femdom threesome

  YesVids windel

• thumb_up 20% 26:41

  Cummy Boxers And Wet Diapers - Penny Barber Video

  xTits windel

• 08:42

  I had an ejaculation in a diaper while milking flawless body

  MatureClub windel

• 18:52

  Adriana gets off grinding hard on a pillow while wearing a messy diaper

  YesVids windel

• 38:17

  Part2 Erotic and Divine figure with sugary-sweet G fun bags and Whipped Body.the Big Ass Is Slippery and the Big Tits Are Swaying!134

  HDSex natürliche

• thumb_up 83% 12:37

  Kimmie: Changes Wet Diaper

  DrTuber webcam

• 07:59

  Ashley Lane - Cum In My Stepdaughters Diaper

  KePorn windel

• 22:48

  Big Fucking Titties Vol4-01

  XXXDan abspritzenwindel

• thumb_up 83% 25:31

  Kira & Steves kinky Adult Diaper Fetish Vol 1 02 - Big Tits, Toys & Blowjobs!

  AroundXXX windel

• thumb_up 62% 13:37

  Treffe mich mit der vollbusigen MILF Xiyu2021, die es liebt, zu verwöhnen und zu spritzen

  XXXVogue oma analoma

• 29:05

  She wants me to wear diapers while fucking

  JizzBunker windel

• 11:10

  Busty aunty with huge ass bangs stepson in hot XXX action - Hindi

  XXXVogue windel

• 10:41

  Big Black Dick Fucking The Skinny Redhead

  XXXDan magersüchtig

• thumb_up 70% 05:27

  Busige Europäerin DashaHart spielt mit ihrer Muschi in Windel

  XXXVogue windel

• thumb_up 60% 05:25

  Kicking diaper WITH MY pounds

  HDSex große titten

• 06:51

  She Humps Your Diaper Till She

  HClips windel

• 05:38

  ABDL Mommies diaper change you and diaper punishment 2018

  SunPorno windel

• 07:22

  Windel-Babysitter, Cuckolds und Windeln

  HClips windel

• 08:12

  Lam, the Cloistered Nun and Your Stepmother: All with a Passion for Diapers

  xHamster nonnewindel

• 03:36

  Open Diaper Dildo Fun

  Upornia windel

• 03:36

  Open Diaper Dildo Fun

  PornDr windel

• 04:54

  Diaper Butt Plug Dildo Orgasm

  PornDr windel

• thumb_up 74% 16:41

  Lesbischer Windelfetisch

  HClips windel

• 05:08

  Diaper Cherry Pussy Insertions

  PornDr windel

• thumb_up 40% 02:04

  Baby diaper pig whore

  xHamster windel

• thumb_up 65% 13:20

  Pro Fection In Diaper Short Compilation

  Upornia gruppe

• 12:01

  Part2 Abundant Gcup Moro Reverse Bunny Anna. Cosplay sex with active JD diaper. Change into reverse bunny costume and hold it

  JizzBunker windel

• 12:13

  Masturbating in a wet diaper

  xHamster windel

• 12:07

  Masturbating In A Wet Diaper

  HClips windel

• thumb_up 82% 2:07:35

  Herbst in Windeln

  Upornia windel

• 01:46

  Fun and flexible, masturbates in diaper

  xHamster windel

• 03:53

  Pillow Hump Fetish With Diapers

  Upornia windel

• 04:23

  Diaper Girls

  HClips windel

• 04:59

  Shy Diaper Girl Uncontrollably Wets Before Humping and Masturbating in Her Warm Soaked Squishy Diaper

  xHamster windel

• 03:20

  Sexy Diaper Girl

  HClips windel

• 09:32

  Girl Masturbating In Diapers Pull Ups

  xHamster windel

• 05:57

  Longpussy, just another walk in the park in a giant butt plug and diaper

  XXXDan kitzler

• 05:44

  Diaper Girl Teases You Pov

  HClips windel

• thumb_up 73% 34:50

  Penney Play In Bitchy Boss wird von männlichem Angestellten Sam Solo gewickelt

  HClips windel

• thumb_up 80% 15:19

  Penney Play - Windelmädchen feminisiert von Stiefvater Abdl Pov

  HClips windel

• 16:37

  Longpussy Just Another Walk At The Beach With A Giant Butt Plug And A Diaper

  HClips windel

• 09:31

  Sexy Farts Inside A Big Completely Dirty Diaper For Your Stepsister

  TXXX windel

• 03:06

  Ich liebe diese Windeln einfach!

  Upornia windel

• thumb_up 82% 20:41

  Longpussy, Long Tits & Laundry then Redbull in the Shower.

  xHamster insertion

• 03:56

  Cam Girls Laugh At Diaper Sissy Messing

  HClips windel

• 03:00

  Baby Doll In In Tutu Plays With Herself In Wet Diaper

  HClips windel

• 05:22

  Handcuffed Diaper Slut Desperately Pees Diaper

  HClips windel

• thumb_up 86% 05:49

  Diaper Girl Shows Her Very Wet Diaper

  Upornia pissen

• thumb_up 60% 13:22

  Penny Barber – Girlfriend Encourages Your Diaper Fetish

  NuVid windel

• 05:56

  Longpussy, just another walk at the Park with a giant Butt Plug and a Diaper.

  xHamster windel

• 13:49

  Big Diaper To Be Filled Completely With Pee In A Garden. Do You Want To Smell It With Me?

  HClips pissenwindel

• 05:18

  Helps You With A Diaper Change - Roxanne Rae

  HClips windel

• 27:42

  Your Beautiful Her Diaper In A Public Garden Full Of Piss 28 Min

  Upornia öffentlichkeitpissen

• 10:14

  Toying with my giant twat while having my own naked spa day at home, close up face

  HDSex windel

• 14:42

  Die Babywindel

  HClips windel

• thumb_up 60% 14:55

  A Nice Diaper To Be Filled With Hot Pee And A Massive Wet Orgasm

  HClips windel

• 14:16

  Oral Fixation Little Humiliation Drooling Spider Gag Lollipop Licking And Diaper Masturbation

  HClips windel

• 14:16

  Oral Fixation Little Humiliation Drooling Spider Gag Lollipop Licking and Diaper Masturbation

  xHamster windel

• thumb_up 80% 01:04

  Longpussy, Walk in the Park Short. Sheer, Short Dress, Diapers and Butt Plugged.

  xHamster windel

• 07:00

  Humiliated BBW Princess Adama Daat Gives Herself Three Piss Enemas, Releases into a Diaper

  xHamster klistier

• 06:52

  BBW ABDL Newbie Adama Daat Diapers, Wets, and Masturbates Herself

  xHamster windel

Beliebte Kategorien

Kostenlose Seiten